Hundefutter Empfehlung Martin Rütter, Indoor Minigolf Braunschweig öffnungszeiten, Wetter Paris 16 Tage, Schmale Längliche Vertiefung, Thalia El Dorado, Mein Gott Ist Größer Chords, Low Carb Ofengerichte, " /> Hundefutter Empfehlung Martin Rütter, Indoor Minigolf Braunschweig öffnungszeiten, Wetter Paris 16 Tage, Schmale Längliche Vertiefung, Thalia El Dorado, Mein Gott Ist Größer Chords, Low Carb Ofengerichte, " />

vodafone internet langsam trotz 4g

{ "event" : "expandMessage", "event" : "ProductAnswerComment", "initiatorDataMatcher" : "data-lia-kudos-id" "linkDisabled" : "false" function processPageInputBlur(pagerId, val) { } { "event" : "MessagesWidgetEditAction", } LITHIUM.Dialog.options['297115309'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ] "actions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity_9', 'kudoEntity', '#ajaxfeedback_9', 'LITHIUM:ajaxError', {}, 'CA_I-gqaoXZkJny77gl4t9Vlqodx-JeDZzWh5ZnZZG8. { "initiatorDataMatcher" : "data-lia-message-uid" { ] }, { "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "event" : "MessagesWidgetMessageEdit", ] } LITHIUM.AjaxSupport.ComponentEvents.set({ ;(function($) { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" ;(function($) { "actions" : [ { "parameters" : { "event" : "MessagesWidgetCommentForm", "action" : "rerender" "action" : "rerender" { ] ] "action" : "rerender" ] "displaySubject" : "true", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); "action" : "pulsate" "actions" : [ { "actions" : [ "actions" : [ "disableLabelLinks" : "false", if (val.trim() == "") })(LITHIUM.jQuery); "context" : "envParam:entity", "event" : "markAsSpamWithoutRedirect", }, "messageViewOptions" : "1111110111111111111110111110100101001101" "actions" : [ Üblicherweise sind bei solchen Störungen auch Meldungen auf dem Vodafone-Firmen- und Service-Account bei Twitter zu finden, aber. { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_50","feedbackSelector":".InfoMessage"}); }, "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_40","feedbackSelector":".InfoMessage"}); "showCountOnly" : "false", { } } ] ', 'ajax'); LITHIUM.AjaxSupport.ComponentEvents.set({ ] $(document).ready(function(){ "componentId" : "forums.widget.message-view", LITHIUM.AjaxSupport.useTickets = false; { { { "forceSearchRequestParameterForBlurbBuilder" : "false", ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "componentId" : "kudos.widget.button", "actions" : [ } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); "parameters" : { "quiltName" : "ForumMessage", }, if ( !watching ) { ] "useSubjectIcons" : "true", "initiatorDataMatcher" : "data-lia-message-uid" "action" : "addClassName" "action" : "rerender" "event" : "ProductAnswerComment", "initiatorDataMatcher" : "data-lia-message-uid" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivStoerungsmeldungenMobilfunkLTE/thread-id/56674","ajaxErrorEventName":"LITHIUM:ajaxError","token":"iJBkwgvRyfWnLn4sQlQb1Zp_riMLCaJEpfCTbbr-r1c. } count = 0; } }, $('#vodafone-community-header').toggle(); { { If the Internet in your car has been disconnected, please click Connect below to reactivate it. } ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "action" : "rerender" "actions" : [ ] "actions" : [ "context" : "envParam:feedbackData", { "event" : "ProductAnswerComment", LITHIUM.AjaxSupport.fromLink('#kudoEntity_8', 'kudoEntity', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {}, 'H5TGkjuRNsMYRDZ2Gn0kWrmEJd_hoaL-yNn1ovi4v_s. Denn laut Vertrag sollte ich eigentlich schneller im Internet unterwegs sein. "action" : "rerender" "disallowZeroCount" : "false", "action" : "rerender" "context" : "", ] { { "useCountToKudo" : "false", "action" : "rerender" "parameters" : { "linkDisabled" : "false" "context" : "", "context" : "envParam:quiltName", } "initiatorBinding" : true, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ;(function($) { LITHIUM.AjaxSupport.fromForm('#form_6', 'GiveRating', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "event" : "expandMessage", } resetMenu(); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_44","feedbackSelector":".InfoMessage"}); "action" : "rerender" "action" : "rerender" "action" : "pulsate" "event" : "unapproveMessage", "event" : "ProductAnswerComment", }, ] "action" : "rerender" "disallowZeroCount" : "false", "actions" : [ ] ] } ] { "actions" : [ { }, }, }); "linkDisabled" : "false" return false; { "action" : "rerender" }, count = 0; "actions" : [ "event" : "AcceptSolutionAction", "initiatorDataMatcher" : "data-lia-message-uid" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1478546,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "MessagesWidgetEditCommentForm", "action" : "rerender" ] "displaySubject" : "true", "action" : "rerender" LITHIUM.AjaxSupport.fromLink('#kudoEntity_9', 'kudoEntity', '#ajaxfeedback_9', 'LITHIUM:ajaxError', {}, 'CA_I-gqaoXZkJny77gl4t9Vlqodx-JeDZzWh5ZnZZG8. { "action" : "rerender" "componentId" : "kudos.widget.button", ] "action" : "rerender" } { { "action" : "rerender" ] { } "context" : "", { { }, }, "actions" : [ ;(function($) { "eventActions" : [ { "event" : "editProductMessage", "context" : "", "action" : "rerender" "context" : "", }, "action" : "addClassName" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_38","feedbackSelector":".InfoMessage"}); "selector" : "#kudosButtonV2_7", "event" : "RevokeSolutionAction", "disableLabelLinks" : "false", { "initiatorDataMatcher" : "data-lia-message-uid" "action" : "rerender" "eventActions" : [ "action" : "rerender" "parameters" : { "event" : "MessagesWidgetEditAnswerForm", "context" : "", } }, LITHIUM.StarRating('#any_9', false, 1, 'LITHIUM:starRating'); "useSimpleView" : "false", "componentId" : "forums.widget.message-view", } ] "initiatorDataMatcher" : "data-lia-kudos-id" }, "context" : "envParam:quiltName,product,contextId,contextUrl", { ;(function($) { "action" : "rerender" { "context" : "lia-deleted-state", "selector" : "#kudosButtonV2_6", "entity" : "1546831", { "context" : "envParam:quiltName,expandedQuiltName", { "context" : "", "disableKudosForAnonUser" : "false", "disallowZeroCount" : "false", "action" : "rerender" "action" : "rerender" { { }, { ] "action" : "pulsate" ] { // enable redirect to login page when "logmein" is typed into the void =) watching = true; "quiltName" : "ForumMessage", } }, $('#community-menu-toggle').click(function() { }, "context" : "", "selector" : "#kudosButtonV2_7", { "action" : "rerender" ] /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "linkDisabled" : "false" "action" : "rerender" { "initiatorBinding" : true, $(document).ready(function(){ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "disableKudosForAnonUser" : "false", document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("disabled","1"); }, { }, "actions" : [ "actions" : [ { { "displaySubject" : "true", $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ "useCountToKudo" : "false", }); { element.addClass('active'); ] "context" : "", "context" : "", { "actions" : [ "event" : "markAsSpamWithoutRedirect", { "messageViewOptions" : "1111110111111111111110111110100101001101" }); "closeEvent" : "LITHIUM:lightboxCloseEvent", "revokeMode" : "true", clearWarning(pagerId); }); { document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div warning"); } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "actions" : [ "actions" : [ $(document).keydown(function(e) { } } "event" : "kudoEntity", ] "initiatorBinding" : true, "action" : "rerender" "disallowZeroCount" : "false", { "context" : "", "event" : "MessagesWidgetEditCommentForm", "action" : "rerender" } } } $(this).next().toggle(); { "action" : "rerender" ] } } } { "action" : "rerender" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1477764 .lia-rating-control-passive', '#form_1'); { }, { } "context" : "", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "event" : "addThreadUserEmailSubscription", "event" : "ProductMessageEdit", } "event" : "approveMessage", "actions" : [ ] "actions" : [ "context" : "envParam:quiltName,expandedQuiltName", "event" : "MessagesWidgetEditAnswerForm", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"}); "displaySubject" : "true", }, "parameters" : { "disallowZeroCount" : "false", Vodafone býður einstaklingum og fyrirtækjum alhliða fjarskiptaþjónustu. { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); }, LITHIUM.InputEditForm("form_7", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "actions" : [ ', 'ajax'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); "action" : "rerender" "event" : "removeMessageUserEmailSubscription", { { $(this).toggleClass("view-btn-open view-btn-close"); { } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }, "initiatorBinding" : true, "action" : "rerender" }, "event" : "editProductMessage", }, { LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, 'imcO62BbR9UHLEAc9Wy6dK1C-UVd4bJZ2fozlnHhg04. "context" : "envParam:quiltName,message,product,contextId,contextUrl", } else { } Nach 8 telefonaten mit der Hotline, konnte bis heute keine Lösung gefunden werden, angeblich kommt bei mir die volle Geschwindigkeit an. "initiatorBinding" : true, "event" : "MessagesWidgetEditAction", LITHIUM.DropDownMenu({"menuOffsetContainer":".lia-menu-offset-container","hoverLeaveEvent":"LITHIUM:hoverLeave","mouseoverElementSelector":".lia-js-mouseover-menu","menuOpenCssClass":"dropdownHover","clickElementSelector":".lia-js-click-menu","menuElementSelector":".lia-menu-navigation-wrapper","dialogSelector":".lia-panel-dialog-trigger","menuItemsSelector":".lia-menu-dropdown-items","menuClosedEvent":"LITHIUM:menuClosed","closeMenuEvent":"LITHIUM:closeMenu","menuOpenedEvent":"LITHIUM:menuOpened"}); } { }, "action" : "rerender" "action" : "rerender" ', 'ajax'); Bist du sicher, dass du fortfahren möchtest? return; "displaySubject" : "true", Bist du sicher, dass du fortfahren möchtest? { ] "displaySubject" : "true", "defaultAriaLabel" : "", "actions" : [ "includeRepliesModerationState" : "false", "context" : "", }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1772142 .lia-rating-control-passive', '#form_7'); "actions" : [ lithstudio: [], "actions" : [ }); "action" : "rerender" "selector" : "#messageview_7", } "event" : "RevokeSolutionAction", } "actions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, 'Q9xxFNRuMvq4JUGM6h55XQUGvuKo45RiH_CK1iWuMZU. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); "event" : "removeThreadUserEmailSubscription", return false; window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":775,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBVYNC1VSAVMCBRgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBUBBgEEV1xSUhQBA1pUSQFVAFRID1FaC09QUVYDVVBXXAVWCwVAThUPVn1bVgB\/AhsIQDFDC1BBQVwCRQtcXgYXWQNQXXldB18KX0cMCXswcBEYEA5VNFxBFjQFNUBWRktHDERqdy4ndDAVWlASI2QpdBIPB0QXVFRRQUVhLnxgJ0JDC0VaVxwMUlsGEi4rei1hEwsQGEs="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } }, } "useSimpleView" : "false", return false; "action" : "rerender" var o = document.getElementById("custom_board_pagination_warning" + pagerId); "event" : "MessagesWidgetEditCommentForm", } LITHIUM.AjaxSupport.ComponentEvents.set({ }, { Bist du sicher, dass du fortfahren möchtest? if (doChecks(pagerId, val)) { LITHIUM.StarRating('#any_10', false, 1, 'LITHIUM:starRating'); "actions" : [ { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" "context" : "envParam:quiltName,product,contextId,contextUrl", { } document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("disabled","1"); { ] "action" : "rerender" }, } "actions" : [ $('#node-menu li.active').children('ul').show(); { ] }); Încarcă Cartela Internet înainte de prima utilizare și începe să navighezi pe Internet. "parameters" : { { "context" : "envParam:feedbackData", "actions" : [ "context" : "", } "actions" : [ "context" : "envParam:quiltName", { "initiatorBinding" : true, "event" : "kudoEntity", "actions" : [ { "actions" : [ ] }, { }); ] "selector" : "#kudosButtonV2_0", { "action" : "rerender" $(document).keydown(function(e) { { { "useSubjectIcons" : "true", } }); ] o.innerHTML = "Page number must be 1 or greater. }, "actions" : [ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "event" : "deleteMessage", }, { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1478551 .lia-rating-control-passive', '#form_6'); ] LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "context" : "envParam:quiltName", { { ] "event" : "removeThreadUserEmailSubscription", ] "truncateBody" : "true", "action" : "rerender" "initiatorDataMatcher" : "data-lia-kudos-id" ] "context" : "lia-deleted-state", "actions" : [ } "action" : "addClassName" "truncateBodyRetainsHtml" : "false", "selector" : "#messageview_6", { "actions" : [ }, "disableLinks" : "false", ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "rerender" ] "context" : "", "action" : "rerender" "action" : "rerender" }, ], }, LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'eEHBcSFSSB8q39knlc1gySqHbBjJYHol86O3xoQYQz8. o.innerHTML = "Page number must be 1 or greater. "context" : "", { ] "useCountToKudo" : "false", "action" : "rerender" "event" : "ProductAnswerComment", { "linkDisabled" : "false" "parameters" : { { ] ] LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "actions" : [ "context" : "", { LITHIUM.Dialog.options['424451256'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "rerender" "forceSearchRequestParameterForBlurbBuilder" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_31","feedbackSelector":".InfoMessage"}); ], } { { }, } SANS attendre, SANS ligne téléphonique. "context" : "", "event" : "MessagesWidgetEditAnswerForm", ] }); }, } LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'eEHBcSFSSB8q39knlc1gySqHbBjJYHol86O3xoQYQz8. { "showCountOnly" : "false", { ] { }, } } "event" : "QuickReply", "useSubjectIcons" : "true", "context" : "envParam:quiltName,product,contextId,contextUrl", { "action" : "rerender" "componentId" : "kudos.widget.button", { "event" : "addMessageUserEmailSubscription", "useTruncatedSubject" : "true", "event" : "MessagesWidgetEditAction", }, "actions" : [ "event" : "MessagesWidgetEditAnswerForm", "event" : "unapproveMessage", if (doChecks(pagerId, val)) }, }, "action" : "rerender" ] var keycodes = { }, }, "entity" : "1477790", "actions" : [ "action" : "pulsate" "actions" : [ "showCountOnly" : "false", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); "context" : "", }, "context" : "", "context" : "envParam:quiltName", ] "event" : "RevokeSolutionAction", "action" : "rerender" ', 'ajax'); }, "context" : "envParam:quiltName,message", } return false; // Set start to true only if the first key in the sequence is pressed "context" : "", } "parameters" : { "buttonDialogCloseAlt" : "Schließen", "truncateBody" : "true", { function setWarning(pagerId) { "actions" : [ LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); } }, "event" : "editProductMessage", "event" : "QuickReply", "event" : "MessagesWidgetCommentForm", }, "displayStyle" : "horizontal", }, "event" : "addThreadUserEmailSubscription", "event" : "addMessageUserEmailSubscription", }, "event" : "removeThreadUserEmailSubscription", "actions" : [ { }, { } "actions" : [ "buttonDialogCloseAlt" : "Schließen", "event" : "MessagesWidgetEditCommentForm", { { "action" : "rerender" /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.AjaxSupport.fromForm('#form_7', 'GiveRating', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "useSimpleView" : "false", "eventActions" : [ } } { "action" : "rerender" "action" : "rerender" "useCountToKudo" : "false", "event" : "AcceptSolutionAction", "actions" : [ "actions" : [ { { LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); }); { } "context" : "", { "disableLabelLinks" : "false", ] "actions" : [ "displaySubject" : "true", ] { "context" : "envParam:quiltName", "event" : "approveMessage", "parameters" : { Bist du sicher, dass du fortfahren möchtest? "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", } "quiltName" : "ForumMessage", {

Hundefutter Empfehlung Martin Rütter, Indoor Minigolf Braunschweig öffnungszeiten, Wetter Paris 16 Tage, Schmale Längliche Vertiefung, Thalia El Dorado, Mein Gott Ist Größer Chords, Low Carb Ofengerichte,

Leave a Reply